PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g032030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 826aa    MW: 93631.5 Da    PI: 9.887
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g032030.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.75.9e-151498194
                    EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                    ffk l     ++++ l +p  f++++ +g + ++kt +l++  s  +W vk+  ++ +    +t+GW++F++a++L++gD+vvF+++g++ f  +v
  Csa14g032030.1 14 FFKPL--LPGFRTH-LDIPVAFFSKYvEGRNDQNKTAKLRSdASDITWLVKM--DGLK----FTDGWEDFASAHDLRTGDIVVFRHEGEMVF--HV 98
                    67777..6677777.99**********77778999****997888*******..6666....***********************9887776..44 PP

2B364.91.3e-20156247799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ++  l+++r ++p +fa++ g++k ++k++ l++e+grsW++ l ++k++ +++lt+GW+ F++ang+ +g   +Fkl++ +++ +v++++r 
  Csa14g032030.1 156 SAWGLSNDRQYIPITFARSKGLNKMRGKKIYLRNEEGRSWKLGLEHDKTGIHTYLTSGWRIFCDANGISQGQQHTFKLVR-RSAPPVIRLCRP 247
                     5667899***********************************************************************98.67779*999985 PP

3B361.21.8e-19269359597
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      +++++l++++l+lp++f++ hg++k++s +++l++e+g +W + l+++k+ + ++l+kGW  F++ ng k gD + Fkl+g + +e+v++++
  Csa14g032030.1 269 SVSPSSLSNDQLYLPRSFVSLHGLEKRCS-EIILKNEQGSKWPLVLKHTKSINLTYLKKGWTIFCDFNGFKIGDPFKFKLSG-TWEEPVLSLC 359
                     56789999*****************9998.****************99999999**************************98.7777888887 PP

4B366.73.4e-21449532690
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     +++++l+++rl+lp +f +++g++k ++k+++l +e+grsW+++l y+k + +++ ++GWk+F++ang+ +g   +Fkl++r ++
  Csa14g032030.1 449 VTASSLRNDRLYLPLSFERSNGLDKMSGKKIVLLNEEGRSWKLNLAYNKAGMHTYVRSGWKSFCDANGMSQGQQYTFKLVRR-TA 532
                     68899*************************************************************************9985.33 PP

5B367.91.5e-21560649697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +++++l+++ l+l ++f++++g++k ++ ++tl++e+gr+W++ l++  +++ +++++GW +F+++ngLk++D++ Fkl++ +++++ ++++
  Csa14g032030.1 560 VSASSLNKDKLYLWRSFVSSNGLDKGCN-KITLKNERGREWTLVLKHYESKRFTIIKRGWTSFCQDNGLKARDSFKFKLVE-TGENPILSLC 649
                     5678889999**************9886.****************99999999*************************998.6777888777 PP

6B349.57.5e-16725821199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ +++ ++++++ l lp  f++ +g++k  ++++tl  ++g +  v l  +kk+g++ ++kGWk+F++a+g+k+ ++++++l++++e+++v+k
  Csa14g032030.1 725 FVTLTLTQSAFETSKLFLPCGFTKVNGINK--PRKITLLGQDGVKRVVDLYQEKKGGTMRFGKGWKQFCEAQGVKVDESFMLELIWEDEASPVLK 817
                     667778899999999********9999995..558********999999966888888********************************9**** PP

                     EE-S CS
              B3  96 vfrk 99 
                     ++ k
  Csa14g032030.1 818 FCTK 821
                     9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.5E-209106IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-1810111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.37811104IPR003340B3 DNA binding domain
CDDcd100179.33E-151299No hitNo description
SMARTSM010192.9E-2214104IPR003340B3 DNA binding domain
PfamPF023622.3E-92196IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-15145245IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.35E-14146249IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.719150248IPR003340B3 DNA binding domain
SMARTSM010193.4E-21151248IPR003340B3 DNA binding domain
PfamPF023623.9E-18156246IPR003340B3 DNA binding domain
CDDcd100171.65E-12160246No hitNo description
Gene3DG3DSA:2.40.330.106.6E-18258359IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-18263360IPR015300DNA-binding pseudobarrel domain
CDDcd100171.73E-15265350No hitNo description
PROSITE profilePS5086313.183265361IPR003340B3 DNA binding domain
SMARTSM010192.7E-22266362IPR003340B3 DNA binding domain
PfamPF023622.1E-18269360IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.9E-18437535IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-17440538IPR015300DNA-binding pseudobarrel domain
CDDcd100171.77E-15444539No hitNo description
PROSITE profilePS5086314.734444542IPR003340B3 DNA binding domain
SMARTSM010195.0E-25445542IPR003340B3 DNA binding domain
PfamPF023625.1E-20449537IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-20548650IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-20550653IPR015300DNA-binding pseudobarrel domain
CDDcd100171.33E-18555650No hitNo description
PROSITE profilePS5086314.029555651IPR003340B3 DNA binding domain
SMARTSM010192.3E-29556652IPR003340B3 DNA binding domain
PfamPF023626.8E-21560650IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.6E-16721820IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-17724820IPR015300DNA-binding pseudobarrel domain
CDDcd100177.02E-11725810No hitNo description
PfamPF023622.9E-15725821IPR003340B3 DNA binding domain
PROSITE profilePS5086311.223725822IPR003340B3 DNA binding domain
SMARTSM010199.0E-18725822IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
MADQSLHSPI KPHFFKPLLP GFRTHLDIPV AFFSKYVEGR NDQNKTAKLR SDASDITWLV  60
KMDGLKFTDG WEDFASAHDL RTGDIVVFRH EGEMVFHVTP LGPSCCEIQY TSSSSHNIND  120
DDETNIVSRN SSRVKKNSRK KMECSSNPFR FVAKVSAWGL SNDRQYIPIT FARSKGLNKM  180
RGKKIYLRNE EGRSWKLGLE HDKTGIHTYL TSGWRIFCDA NGISQGQQHT FKLVRRSAPP  240
VIRLCRPKPR PKQRSESESP LDHSCFQGSV SPSSLSNDQL YLPRSFVSLH GLEKRCSEII  300
LKNEQGSKWP LVLKHTKSIN LTYLKKGWTI FCDFNGFKIG DPFKFKLSGT WEEPVLSLCP  360
VEPNRAKNPL KCSAGSDDVN PEESEEDKNI SQECLEIKKR KYRSRCRASV ENMDDDQTNI  420
VTGNSSRAKK GPRKTVESSS DHLSFVGNVT ASSLRNDRLY LPLSFERSNG LDKMSGKKIV  480
LLNEEGRSWK LNLAYNKAGM HTYVRSGWKS FCDANGMSQG QQYTFKLVRR TAPPVMRLYL  540
AKHRPKPESS SQHSYFVGSV SASSLNKDKL YLWRSFVSSN GLDKGCNKIT LKNERGREWT  600
LVLKHYESKR FTIIKRGWTS FCQDNGLKAR DSFKFKLVET GENPILSLCP ADSNRDKTPL  660
EYAEGIDNVK SLSSSPSSGD DSSRSKKSED ESIEDKNISQ DCLEIKKRKY CLNCRASYSY  720
TPKQFVTLTL TQSAFETSKL FLPCGFTKVN GINKPRKITL LGQDGVKRVV DLYQEKKGGT  780
MRFGKGWKQF CEAQGVKVDE SFMLELIWED EASPVLKFCT KVNSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010460279.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X1
SwissprotQ84WP30.0REM17_ARATH; B3 domain-containing protein REM17
TrEMBLR0GPB90.0R0GPB9_9BRAS; Uncharacterized protein
STRINGscaffold_102864.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.10.0B3 family protein